Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF1 (A67T) (Human) Recombinant Protein 

  • Catalog # : P8181
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF1 (P05019, 48 a.a. - 118 a.a.) A67T mutant partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3479
  • Gene Name:
  • IGF1
  • Gene Alias:
  • IGFI
  • Gene Description:
  • insulin-like growth factor 1 (somatomedin C)
  • Gene Summary:
  • The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • insulin-like growth factor 1,somatomedin C
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook