Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IRF1 (Human) Recombinant Protein 

  • Catalog # : P8171
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IRF1 (P10914, 1 a.a. - 114 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 20mM Tris pH 8 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3659
  • Gene Name:
  • IRF1
  • Gene Alias:
  • IRF-1,MAR
  • Gene Description:
  • interferon regulatory factor 1
  • Gene Summary:
  • IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion. [provided by RefSeq
  • Other Designations:
  • interferon regulatory factor-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook