Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IFNGR1 (Human) Recombinant Protein 

  • Catalog # : P8168
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNGR1 (P15260, 18 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
  • Sequence:
  • EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH
  • Host:
  • insect
  • Theoretical MW (kDa):
  • 26.6
  • Form:
  • Liquid
  • Preparation Method:
  • Sf9 cell expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3459
  • Gene Name:
  • IFNGR1
  • Gene Alias:
  • CD119,FLJ45734,IFNGR
  • Gene Description:
  • interferon gamma receptor 1
  • Gene Summary:
  • This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq
  • Other Designations:
  • AVP, type 2,CD119 antigen,OTTHUMP00000017285,antiviral protein, type 2,immune interferon receptor 1,interferon-gamma receptor alpha chain
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook