Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IFNG (Human) Recombinant Protein BioActive

  • Catalog # : P8158
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNG (P01579, 24 a.a. - 161 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.4
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • The ED50?is < 5 ng/mL, measured in a cytotoxicity assay using WiDr cells.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS pH 7.4 (20% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3458
  • Gene Name:
  • IFNG
  • Gene Alias:
  • IFG,IFI
  • Gene Description:
  • interferon, gamma
  • Gene Summary:
  • Interferon-gamma (IFNG), or type II interferon, is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFNG in the immune system stems in part from its ability to inhibit viral replication directly, but most importantly derives from its immunostimulatory and immunomodulatory effects. IFNG is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 (MIM 186940) and CD8 (see MIM 186910) cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops (Schoenborn and Wilson, 2007 [PubMed 17981204]).[supplied by OMIM
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook