Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IFNB1 (Human) Recombinant Protein BioActive

  • Catalog # : P8153
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNB1 (P01574, 22 a.a. - 187 a.a.) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
  • Host:
  • Mammals
  • Theoretical MW (kDa):
  • 22.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purity:
  • > 99.0% by SDS-PAGE
  • Activity:
  • The specific activity as determined in a viral resistance assay (human "Wish" cell line and VSV virus or the monkey VERO cell line with EMCV virus) was found to be 270 x 106 IU/mg.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3456
  • Gene Name:
  • IFNB1
  • Gene Alias:
  • IFB,IFF,IFNB,MGC96956
  • Gene Description:
  • interferon, beta 1, fibroblast
  • Other Designations:
  • OTTHUMP00000021131,interferon beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook