Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

HBsAg (adw) Recombinant Protein 

  • Catalog # : P8134
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • HBsAg (adw) recombinant protein expressed in Pichia pastoris.
  • Sequence:
  • MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI?
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 24
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Storage Buffer:
  • In 20 mM phosphate buffer, 154 mM NaCl2, pH 7.1.
  • Storage Instruction:
  • Store at 4°C, do not freezed .
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • HBVgp4
  • Gene Alias:
  • -
  • Gene Description:
  • precore/core protein
  • Other Designations:
  • Core and e antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook