Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Lif (Mouse) Recombinant Protein BioActive

  • Catalog # : P8133
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse LIF (P09056) recombinant protein expressed in Escherichia coli .
  • Sequence:
  • MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
    > 95% RP-HPLC
  • Activity:
  • Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/mL, corresponding to a specific activity of 100,000,000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
  • Storage Buffer:
  • Lyophilized from 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20
  • Storage Instruction:
  • Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°Cbetween 2-7 days and for future use below -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Lif
  • Gene Alias:
  • -
  • Gene Description:
  • leukemia inhibitory factor
  • Other Designations:
  • OTTMUSP00000005253
  • RSS
  • YouTube
  • Linkedin
  • Facebook