Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

FGF2 (Human) Recombinant Protein BioActive

  • Catalog # : P8130
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF2 (P09038) recombinant protein expressed in Escherichia coli .
  • Sequence:
  • AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Activity:
  • The ED50, calculated by the dose-dependant proliferation of murine balb/c 3T3 cells is < 0.1ng/ml, corresponding to a specific activity of graeter than 1.0x107 Units/mg.
  • Storage Buffer:
  • Lyophilized from 20mM Tris-HCl, pH7.4 and 1M NaCl
  • Storage Instruction:
  • Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C.
    Aliquot to avoid repeated freezing and thawing. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2247
  • Gene Name:
  • FGF2
  • Gene Alias:
  • BFGF,FGFB,HBGF-2
  • Gene Description:
  • fibroblast growth factor 2 (basic)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq
  • Other Designations:
  • basic fibroblast growth factor bFGF,fibroblast growth factor 2,heparin-binding growth factor 2,prostatropin
  • RSS
  • YouTube
  • Linkedin
  • Facebook