Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Lif (Mouse) Recombinant Protein BioActive

  • Catalog # : P8114
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Lif recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
  • Sequence:
  • SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to induce IL-6 secretion in M1 cells. The ED50 for this effect is < 0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 106 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P8114
    SDS-PAGE analysis of Lif (Mouse) Recombinant Protein.
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Lif
  • Gene Alias:
  • -
  • Gene Description:
  • leukemia inhibitory factor
  • Other Designations:
  • OTTMUSP00000005253
  • RSS
  • YouTube
  • Linkedin
  • Facebook