Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CD47 (Human) Recombinant Protein BioActive

  • Catalog # : P8101
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD47 (Q08722, 19 a.a. - 141 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
  • Sequence:
  • QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 14.7
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • Measured by its binding ability in a functional ELISA with Human SIRP gamma/CD172g.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8101
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 961
  • Gene Name:
  • CD47
  • Gene Alias:
  • IAP,MER6,OA3
  • Gene Description:
  • CD47 molecule
  • Gene Summary:
  • This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Four alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CD47 antigen,CD47 antigen (Rh-related antigen, integrin-associated signal transducer),CD47 glycoprotein,Rh-related antigen,antigen identified by monoclonal antibody 1D8,antigenic surface determinant protein OA3,integrin associated protein,integrin-associa
  • RSS
  • YouTube
  • Linkedin
  • Facebook