Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Chst5 (Mouse) Recombinant Protein BioActive

  • Catalog # : P8095
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Chst5 (Q9QUP4, 27 a.a. - 395 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
  • Sequence:
  • SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWASSTEKQPES
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 42.9
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • Specific activity is > 10000 pmol/min/ug, and is defined as the amount of enzyme that sulfate from PAPS to N-acetyl-D-glucosamine per minute at pH 7.5, at 37°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8095
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (20% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Chst5
  • Gene Alias:
  • AI173964,GST-4,I-GlcNAc-6-ST
  • Gene Description:
  • carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
  • Other Designations:
  • I-GlcNAc6ST
  • RSS
  • YouTube
  • Linkedin
  • Facebook