Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Cd200 (Mouse) Recombinant Protein BioActive

  • Catalog # : P8082
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Cd200 (O54901, 31 a.a. - 232 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
  • Sequence:
  • QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 23.5
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • Measured by its binding ability in a functional ELISA with Mouse CD200 R1.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8082
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Cd200
  • Gene Alias:
  • Mox2,OX2
  • Gene Description:
  • CD200 antigen
  • Other Designations:
  • Cd200 antigen,MRC OX-2,antigen identified by monoclonal antibody MRC OX-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook