Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL6R (Human) Recombinant Protein BioActive

  • Catalog # : P8068
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL6R (P08887, 20 a.a. - 365 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
  • Sequence:
  • LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 39.6
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 20 ng/mL, determined by its ability to inhibit proliferation using M1 mouse myeloid leukemia cells with Human IL-6.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8068
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3570
  • Gene Name:
  • IL6R
  • Gene Alias:
  • CD126,IL-6R-1,IL-6R-alpha,IL6RA,MGC104991
  • Gene Description:
  • interleukin 6 receptor
  • Gene Summary:
  • Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • CD126 antigen,OTTHUMP00000034320,interleukin 6 receptor alpha subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook