Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL9 (Human) Recombinant Protein BioActive

  • Catalog # : P8063
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL9 (P15248, 19 a.a. - 144 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
  • Sequence:
  • QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 14.9
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 85% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 0.3 ng/mL, measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8063
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3578
  • Gene Name:
  • IL9
  • Gene Alias:
  • HP40,IL-9,P40
  • Gene Description:
  • interleukin 9
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000159423,T-cell growth factor p40,homolog of mouse T cell and mast cell growth factor 40,p40 T-cell and mast cell growth factor,p40 cytokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook