Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

VTN (Human) Recombinant Protein BioActive

  • Catalog # : P8056
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VTN (P04004, 20 a.a. - 478 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
  • Sequence:
  • DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 53.3
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • Measured by the ability of the immobilized protein to support the adhesion of B16-F10 mouse melanoma cells. When cells are added to VTN coated plates 5 ug/ml. This effect is more to 50%.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8056
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7448
  • Gene Name:
  • VTN
  • Gene Alias:
  • V75,VN,VNT
  • Gene Description:
  • vitronectin
  • Gene Summary:
  • The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. [provided by RefSeq
  • Other Designations:
  • complement S-protein,epibolin,serum spreading factor,somatomedin B,vitronectin (serum spreading factor, somatomedin B, complement S-protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook