Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EFNA1 (Human) Recombinant Protein BioActive

  • Catalog # : P8046
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EFNA1 (P20827, 19 a.a. - 182 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
  • Sequence:
  • DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 46.6
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 50 ng/mL, measured by its binding ability in a functional ELISA with Human EPHA2.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8046
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1942
  • Gene Name:
  • EFNA1
  • Gene Alias:
  • B61,ECKLG,EFL1,EPLG1,LERK1,TNFAIP4
  • Gene Description:
  • ephrin-A1
  • Gene Summary:
  • This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033242,OTTHUMP00000033271,eph-related receptor tyrosine kinase ligand 1,ephrin A1,immediate early response protein B61,ligand of eph-related kinase 1,tumor necrosis factor, alpha-induced protein 4
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook