Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

BGN (Human) Recombinant Protein BioActive

  • Catalog # : P8045
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BGN (P21810, 38 a.a. - 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
  • Sequence:
  • DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 38.3
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 20 ug/mL, measured in inhibit the cell growth using 3T3-L1 mouse embryonic fibroblast adipose-like cells.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8045
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 633
  • Gene Name:
  • BGN
  • Gene Alias:
  • DSPG1,PG-S1,PGI,SLRR1A
  • Gene Description:
  • biglycan
  • Gene Summary:
  • The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025928,biglycan proteoglycan,bone/cartilage proteoglycan-I,dermatan sulphate proteoglycan I,small leucine-rich protein 1A
  • RSS
  • YouTube
  • Linkedin
  • Facebook