Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TNFRSF10B (Human) Recombinant Protein BioActive

  • Catalog # : P8039
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
  • Sequence:
  • ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTS
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 43.9
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 5 ng/mL, measured by by its ability to inhibit cytotoxicity using Jurkat human acute T cell leukemia cells with Human TRAIL.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8039
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8795
  • Gene Name:
  • TNFRSF10B
  • Gene Alias:
  • CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fas-like protein,OTTHUMP00000123492,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,apoptosis inducing protein TRICK2A/2B,apoptosis inducing receptor TRAIL-R2,cytotoxic TRAIL receptor-2,death domain containing receptor for TRAIL/Apo-2L,d
  • RSS
  • YouTube
  • Linkedin
  • Facebook