Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Ak2 (Mouse) Recombinant Protein BioActive

  • Catalog # : P8032
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Ak2 (Q9WTP6, 1 a.a. - 239 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MAPNVLASEPEIPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAFSKATCKDLVMFI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 29
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is > 40 unit/mg, in which one unit will convert 2.0 umoles of ADP to ATP + AMP per minute at pH 7.5 at 37°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8032
  • Storage Buffer:
  • In 20mM Tris-HCl pH 8.5 (10% glycerol, 1 mM DTT)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ak2
  • Gene Alias:
  • Ak-2,D4Ertd220e
  • Gene Description:
  • adenylate kinase 2
  • Other Designations:
  • OTTMUSP00000010093,OTTMUSP00000010094
  • RSS
  • YouTube
  • Linkedin
  • Facebook