Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CSF2RA (Human) Recombinant Protein BioActive

  • Catalog # : P8030
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CSF2RA (P15509, 20 a.a. - 320 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
  • Sequence:
  • LIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 35.9
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50 is < 10 ug/mL, measured by by its ability to inhibit proliferation using TF-1 human erythroleukemic cells.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8030
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1438
  • Gene Name:
  • CSF2RA
  • Gene Alias:
  • CD116,CDw116,CSF2R,CSF2RAX,CSF2RAY,CSF2RX,CSF2RY,GM-CSF-R-alpha,GMCSFR,GMR,MGC3848,MGC4838
  • Gene Description:
  • colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
  • Gene Summary:
  • The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq
  • Other Designations:
  • CD116 antigen,GM-CSF receptor alpha subunit,OTTHUMP00000014504,OTTHUMP00000014505,OTTHUMP00000014917,OTTHUMP00000014918,colony stimulating factor 2 receptor alpha chain,colony stimulating factor 2 receptor alpha subunit,granulocyte-macrophage colony-stimu
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook