Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD48 (Human) Recombinant Protein BioActive

  • Catalog # : P8024
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD48 (P09326, 27 a.a. - 220 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
  • Sequence:
  • QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 23.4
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • Measured by its binding ability in a functional ELISA with Human CD244
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8024
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 962
  • Gene Name:
  • CD48
  • Gene Alias:
  • BCM1,BLAST,BLAST1,MEM-102,SLAMF2,hCD48,mCD48
  • Gene Description:
  • CD48 molecule
  • Gene Summary:
  • BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.[supplied by OMIM
  • Other Designations:
  • CD48 antigen (B-cell membrane protein),OTTHUMP00000025680,OTTHUMP00000060268
  • RSS
  • YouTube
  • Linkedin
  • Facebook