Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Cst3 (Mouse) Recombinant Protein BioActive

  • Catalog # : P8018
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Cst3 (P21460, 21 a.a. - 140 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
  • Sequence:
  • ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 14.2
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • The IC50 value is < 1.0 nM, was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8018
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Cst3
  • Gene Alias:
  • CysC
  • Gene Description:
  • cystatin C
  • Other Designations:
  • OTTMUSP00000016736,cystatin 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook