Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

DUSP23 (Human) Recombinant Protein BioActive

  • Catalog # : P8013
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DUSP23 (Q9BVJ7, 1 a.a. - 150 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.8
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity is > 200 unit/mg, and is defined as the amount of enzyme that hydrolyze 1.0 nmole of p-nitrophenyl phosphate (pNPP) per minute at pH 7.5 at 37°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8013
  • Storage Buffer:
  • In 20mM Tris-HCl pH 8.0 (10% glycerol, 100 mM NaCl, 2 mM DTT)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • DUSP23
  • Gene Alias:
  • DUSP25,FLJ20442,LDP-3,MOSP,RP11-190A12.1,VHZ
  • Gene Description:
  • dual specificity phosphatase 23
  • Other Designations:
  • OTTHUMP00000024412,OTTHUMP00000024413,OTTHUMP00000033306,VH1-like member Z,low-molecular-mass dual-specificity phosphatase 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook