Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

DUSP18 (Human) Recombinant Protein BioActive

  • Catalog # : P8012
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DUSP18 (Q8NEJ0, 1 a.a. - 188 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is > 300 unit/mg, and is defined as the amount of enzyme that hydrolyze 1.0 nmole of p-nitrophenyl phosphate (pNPP) per minute at pH 7.5 at 37°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8012
  • Storage Buffer:
  • In 20mM Tris-HCl pH 8.0 (40% glycerol, 1 mM EDTA, 1 mM DTT, 0.1 mM PMSF)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • DUSP18
  • Gene Alias:
  • DSP18,DUSP20,LMWDSP20,MGC32658,bK963H5.1
  • Gene Description:
  • dual specificity phosphatase 18
  • Gene Summary:
  • DUSP18 is a member of the dual-specificity phosphatase (DSP) family (see DUSP1; MIM 600714), which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues (Hood et al., 2002 [PubMed 12408986]).[supplied by OMIM
  • Other Designations:
  • low molecular weight dual specificity phosphatase 20
  • RSS
  • YouTube
  • Linkedin
  • Facebook