Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CD244 (Human) Recombinant Protein BioActive

  • Catalog # : P8009
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
  • Sequence:
  • GKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQE
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 50.2
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • ED50?is < 0.1 ug/mL, measured by its binding ability in a functional ELISA with Human CD48/SLAMF2.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8009
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CD244
  • Gene Alias:
  • 2B4,NAIL,NKR2B4,Nmrk,SLAMF4
  • Gene Description:
  • CD244 molecule, natural killer cell receptor 2B4
  • Gene Summary:
  • Natural killer (NK) cells express both activating and inhibitory cell surface receptors. Inhibitory signaling receptors all possess cytoplasmic immunoreceptor tyrosine-based inhibitory motifs, or ITIMs, whereas the activating receptors lack ITIMs and associate with DAP12 (TYROBP; MIM 604142), which contains an immunoreceptor tyrosine-based activation motif, or ITAM. Killer cell immunoglobulin (Ig)-like receptors, or KIRs (see KIR2DL1; MIM 604936), and other NK cell receptors interact with major histocompatibility complex (MHC) molecules (see MIM 142800). Members of the CD2 (MIM 186990) family adhere to each other instead. The cell surface glycoprotein 2B4 is related to CD2 and is implicated in the regulation of NK- and T-cell function (Boles et al., 1999 [PubMed 10458320]).[supplied by OMIM
  • Other Designations:
  • CD244 natural killer cell receptor 2B4,NK cell activation inducing ligand NAIL,OTTHUMP00000027884,natural killer cell receptor 2B4
  • RSS
  • YouTube
  • Linkedin
  • Facebook