Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Ppif (Rat) Recombinant Protein BioActive

  • Catalog # : P8000
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • CSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity is > 1300 nmol/min/ug, and is defined as the amount of enzyme that cleaves 1 nmol of suc-AAPF-pNA per minute at 37°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P8000
  • Storage Buffer:
  • In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ppif
  • Gene Alias:
  • MGC93084,PPIase
  • Gene Description:
  • peptidylprolyl isomerase F (cyclophilin F)
  • Other Designations:
  • Peptidyl-prolyl cis-trans isomerase,cyclophilin D,cyclophilin F,peptidylprolyl isomerase F,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook