Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

HPRT1 (Human) Recombinant Protein BioActive

  • Catalog # : P7992
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HPRT1 (P00492, 1 a.a. - 218 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.7
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is > 15 unit/mg, and is defined as the amount of enzyme that catalyze the formation of 1 umole of guanosine 5-monophosphate(GMP) per minute from guanine and phosphoribosyl pyrophosphate at pH 7.5 at 37°C.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P7992
  • Storage Buffer:
  • In 20mM Tris-HCl pH 8.0 (20% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3251
  • Gene Name:
  • HPRT1
  • Gene Alias:
  • HGPRT,HPRT
  • Gene Description:
  • hypoxanthine phosphoribosyltransferase 1
  • Gene Summary:
  • The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook