Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

GLUL (Human) Recombinant Protein BioActive

  • Catalog # : P7988
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 44.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity is > 2800 pmol/min/ug, and is defined as the amount of enzyme that convert 1.0 pmole of L-glutamate to L-glutamine per miunte at pH 7.5 at 37°C in coupled system with PK/LDH.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

    QC Testing of P7988
  • Storage Buffer:
  • In 20mM Tris-HCl pH 8.0 (20% glycerol, 200 mM NaCl, 5 mM DTT)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2752
  • Gene Name:
  • GLUL
  • Gene Alias:
  • GLNS,GS,PIG43,PIG59
  • Gene Description:
  • glutamate-ammonia ligase (glutamine synthetase)
  • Gene Summary:
  • Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000035524,OTTHUMP00000035525,cell proliferation-inducing protein 59,glutamate-ammonia ligase (glutamine synthase),glutamine synthetase,proliferation-inducing protein 43
  • RSS
  • YouTube
  • Linkedin
  • Facebook