Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CSF3 (Human) Recombinant Protein BioActive

  • Catalog # : P7860
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CSF3 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
  • Sequence:
  • TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 < 50 pg/mL, measure by its ability to induce proliferation in NFS-60 cells. The specific activity of recombinant human G-CSF is > 2 x 107 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7860
    SDS-PAGE analysis of CSF3 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1440
  • Gene Name:
  • CSF3
  • Gene Alias:
  • G-CSF,GCSF,MGC45931
  • Gene Description:
  • colony stimulating factor 3 (granulocyte)
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164327,colony stimulating factor 3,filgrastim,granulocyte colony stimulating factor,lenograstim,pluripoietin
  • RSS
  • YouTube
  • Linkedin
  • Facebook