Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TGFBR2 (Human) Recombinant Protein BioActive

  • Catalog # : P7856
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFBR2 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.01 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 < 0.2 ng/mL, measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The specific activity of recombinant human TGF beta 2 is > 5 x 106 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7856
    SDS-PAGE analysis of TGFBR2 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7048
  • Gene Name:
  • TGFBR2
  • Gene Alias:
  • AAT3,FAA3,LDS1B,LDS2B,MFS2,RIIC,TAAD2,TGFR-2,TGFbeta-RII
  • Gene Description:
  • transforming growth factor, beta receptor II (70/80kDa)
  • Gene Summary:
  • This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq
  • Other Designations:
  • TGF-beta receptor type IIB,TGF-beta type II receptor,transforming growth factor beta receptor type IIC,transforming growth factor, beta receptor II,transforming growth factor, beta receptor II (70-80kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook