Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IGF2 (Human) Recombinant Protein BioActive

  • Catalog # : P7854
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF2 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
  • Sequence:
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 < 3 ng/mL, measure by its ability to induce MCF-7 cells proliferation. The specific activity of recombinant human IGF-II is > 3 x 105 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7854
    SDS-PAGE analysis of IGF2 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3481
  • Gene Name:
  • IGF2
  • Gene Alias:
  • C11orf43,FLJ22066,FLJ44734,INSIGF,pp9974
  • Gene Description:
  • insulin-like growth factor 2 (somatomedin A)
  • Gene Summary:
  • This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011012,OTTHUMP00000011015,OTTHUMP00000011018,OTTHUMP00000011157,insulin-like growth factor 2,insulin-like growth factor II,insulin-like growth factor type 2,putative insulin-like growth factor II associated protein,somatomedin A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook