Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IGF1 (Human) Recombinant Protein BioActive

  • Catalog # : P7853
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.01 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 is 0.9-3.1 ng/mL, measure by its ability to induce MCF-7 cells proliferation. The specific activity of recombinant human IGF-I is > 1.2 x 103 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7853
    SDS-PAGE analysis of FGF11 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3479
  • Gene Name:
  • IGF1
  • Gene Alias:
  • IGFI
  • Gene Description:
  • insulin-like growth factor 1 (somatomedin C)
  • Gene Summary:
  • The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • insulin-like growth factor 1,somatomedin C
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook