Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

VEGFA (Human) Recombinant Protein BioActive

  • Catalog # : P7848
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VEGFA (VEGF165) recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 < 5 ng/mL, measure by its ability to induce HUVEC cells proliferation. The specific activity of recombinant human VEGF165 is > 1.4 x 106 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7848
    SDS-PAGE analysis of VEGFA (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7422
  • Gene Name:
  • VEGFA
  • Gene Alias:
  • MGC70609,VEGF,VEGF-A,VPF
  • Gene Description:
  • vascular endothelial growth factor A
  • Gene Summary:
  • This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq
  • Other Designations:
  • vascular endothelial growth factor isoform VEGF165,vascular permeability factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook