Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

NGF8 (Human) Recombinant Protein BioActive

  • Catalog # : P7847
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF8 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR with polyhistidine tag at the C-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 is 1.4-3.8 ng/mL, measure by its ability to induce 3T3 cells proliferation. The specific activity of recombinant human FGF-8b is > 2 x 105 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7847
    SDS-PAGE analysis of NGF8 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2253
  • Gene Name:
  • FGF8
  • Gene Alias:
  • AIGF,HBGF-8,MGC149376
  • Gene Description:
  • fibroblast growth factor 8 (androgen-induced)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020348,OTTHUMP00000020349,OTTHUMP00000020350,OTTHUMP00000020351,androgen-induced growth factor,fibroblast growth factor 8
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook