Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TGFB1 (Human) Recombinant Protein BioActive

  • Catalog # : P7834
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFB1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU/ ug of protein by the LAL method.
  • Activity:
  • ED50 < 0.1 ng/mL, measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The specific activity of recombinant human TGF beta 1 is > 5 x 107 IU/mg. ED50 < 3.2 ng/mL, measure by its ability to induce proliferation in MCF-7 cells.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue.

    QC Testing of P7834
    SDS-PAGE analysis of TGFB1 (Human) Recombinant Protein.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C.
    Avoid repeated freeze/thaw cycles.
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7040
  • Gene Name:
  • TGFB1
  • Gene Alias:
  • CED,DPD1,TGFB,TGFbeta
  • Gene Description:
  • transforming growth factor, beta 1
  • Gene Summary:
  • TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM
  • Other Designations:
  • TGF-beta 1 protein,diaphyseal dysplasia 1, progressive,transforming growth factor-beta 1
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook