Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EGF (Human) Recombinant Protein BioActive

  • Catalog # : P7534
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EGF (P01133, 971 a.a. - 1023 a.a.) partial recombinant protein with His tag at C-teminus expressed with an N terminal Met in Escherichia coli.
  • Sequence:
  • NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.2 EU per 1 ug of protein (determined by gel clotting method)
  • Activity:
  • The ED50 was determined by a cell proliferation assay using Balb/c 3T3 cells is < 0.2 ng/mL, corresponding to a specific activity of > 5.0 × 106 units/mg.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water up to 100 ug/mL
  • Storage Instruction:
  • Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1950
  • Gene Name:
  • EGF
  • Gene Alias:
  • HOMG4,URG
  • Gene Description:
  • epidermal growth factor (beta-urogastrone)
  • Gene Summary:
  • Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq
  • Other Designations:
  • urogastrone
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook