Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Cxcl2 (Mouse) Recombinant Protein BioActive

  • Catalog # : P7516
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Cxcl2 (P10889, 28 a.a. - 100 a.a.) partial recombinant protein expressed in HEK293 cell.
  • Sequence:
  • AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
  • Host:
  • Mammals
  • Theoretical MW (kDa):
  • 7.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.2 EU per 1 ug of protein (determined by gel clotting method)
  • Activity:
  • The ED50 was determined on Ca2+ mobilization assay in CHO-K1/mCXCR2 (mouse CXCR2 stably expressed in CHO-K1 cells) is < 200.0 ng/mL.
  • Recommend Usage:
  • Reconstitute the lyophilized powder in ddH?O or PBS up to 100 ug/mL.
  • Storage Buffer:
  • Lyophilized from a 0.2 μm filtered solution in PBS.
  • Storage Instruction:
  • Upon reconstitution, store at 4°C for up to 1 week or store at -20°C up to 3 months.
    For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Cxcl2
  • Gene Alias:
  • CINC-2a,GROb,Gro2,MIP-2,MIP-2a,Mgsa-b,Mip2,Scyb,Scyb2
  • Gene Description:
  • chemokine (C-X-C motif) ligand 2
  • Other Designations:
  • small inducible cytokine subfamily, member 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook