Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CSF2 (Rhesus Macaque) Recombinant Protein BioActive

  • Catalog # : P7177
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rhesus Macaque CSF2 (Q9GL44, 18 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 14.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • The ED50 was determined by a cell proliferation assay using human TF-1 cells cells is < 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 107 IU/mg.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
  • Storage Instruction:
  • Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • GM-CSF
  • Gene Alias:
  • CSF2
  • Gene Description:
  • granulocyte-macrophage colony-stimulating factor
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook