Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL13 (Human) Recombinant Protein BioActive

  • Catalog # : P7154
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL13 (P35225, 35 a.a. - 146 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12.3
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 97% by SDS-PAGE
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method)
  • Activity:
  • The ED50 was determined by the cell proliferation assay using human TF-1 cells is < 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 106 IU/mg.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
  • Storage Instruction:
  • Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3596
  • Gene Name:
  • IL13
  • Gene Alias:
  • ALRH,BHR1,IL-13,MGC116786,MGC116788,MGC116789,P600
  • Gene Description:
  • interleukin 13
  • Gene Summary:
  • This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook