Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

THPO (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7007
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human THPO recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
  • Sequence:
  • SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.01 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to induce proliferation in MO7e cells. The ED 50 for this effect is < 2 ng/mL.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7007
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.4.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <2 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7066
  • Gene Name:
  • THPO
  • Gene Alias:
  • MGC163194,MGDF,MKCSF,ML,MPLLG,TPO
  • Gene Description:
  • thrombopoietin
  • Gene Summary:
  • Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. [provided by RefSeq
  • Other Designations:
  • MPL ligand,c-mpl ligand,megakaryocyte colony-stimulating factor,megakaryocyte growth and development factor,megakaryocyte stimulating factor,myeloproliferative leukemia virus oncogene ligand,thrombopoietin nirs variant 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook