Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNG (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7003
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNG recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE analysis.
  • Endotoxin Level:
  • < 0.01 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant human IFNG is approximately > 1 x 108 IU/ mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7003
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 8.0.
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.Please use within one month after protein reconstitution.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3458
  • Gene Name:
  • IFNG
  • Gene Alias:
  • IFG,IFI
  • Gene Description:
  • interferon, gamma
  • Gene Summary:
  • Interferon-gamma (IFNG), or type II interferon, is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFNG in the immune system stems in part from its ability to inhibit viral replication directly, but most importantly derives from its immunostimulatory and immunomodulatory effects. IFNG is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 (MIM 186940) and CD8 (see MIM 186910) cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops (Schoenborn and Wilson, 2007 [PubMed 17981204]).[supplied by OMIM
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook