Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL21 (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7001
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL21 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLE RFKSLLQKMIHQHLSSRTHGSEDS
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE analysis.
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is < 10 ng/mL.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7001
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 8.0.
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.Please use within one month after protein reconstitution.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL21
  • Gene Alias:
  • IL-21,Za11
  • Gene Description:
  • interleukin 21
  • Other Designations:
  • interleukin-21 isoform
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook