Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

S (SARS-CoV-2 Beta Variant) RBD Recombinant Protein Coronavirus

  • Catalog # : P6703
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • SARS-CoV-2 Beta Variant S RBD (GISAID No. EPI_ISL_736980, 319 a.a. - 541 a.a.) K417N, E484K, N501Y mutant recombinant protein with 6xHis tag at C-terminus expressed in HEK293 cells.
  • Sequence:
  • RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  • Host:
  • Human
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purification:
  • Affinity purification with Nickel Columns
  • Purity:
  • >= 95% by SDS-PAGE.
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by LAL test.
  • Quality Control Testing:
  • SDS-PAGE

    QC Testing of P6703
  • Recommend Usage:
  • ELISA
    SDS-PAGE
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS.
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Application Image
  • Western Blot (Recombinant protein)
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook