Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SARS-CoV-2 S RBD (B.1.1.7) Recombinant Protein Coronavirus

  • Catalog # : P6695
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified SARS-CoV-2 S RBD (B.1.1.7) (YP_009724390.1, 316 a.a. - 538 a.a.) COVID-19 recombinant protein with Rabbit Fc tag at C-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
  • Theoretical MW (kDa):
  • 49.28
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of SARS-CoV-2 S RBD (B.1.1.7) plasmid into HEK293H cell, and the expressed protein was purified by protein A.
  • Purification:
  • Protein A purification
  • Concentration:
  • >= 10 ug/ml
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of P6695

    Western Blot
    QC Testing of P6695
  • Storage Buffer:
  • In PBS.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook