Last updated: 2023/3/19

Click this icon to add products to compare list. Select up to 10 products.

FGF19 (Human) Recombinant Protein

Product Description:
Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in E. Coli.

Sequence:
MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Endotoxin Level:
Endotoxin level was found to be less than 0.1 ng/ug (1 EU/ug). Endotoxin content was assayed using a LAL gel clot method.

Activity:
Human FGF19 activity determined by proliferation assay of mouse 3T3 cells at l ug/mL (100 uL/Well). Dose response curve for FGF19 with the EC50 of 0.1 ug/mL.

Storage Instruction:
Stored lyophilized product at -20°C.
After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, store at -20°C for 12 months or store at 2-8°C for 3 weeks.
Aliquot to avoid repeated freezing and thawing.
Centrifuge vial to ensure maximal product extraction, recommended: 20 sec, 5K RPM.
For long term storage we recommend the addition of a carrier protein at 0.1%.

Gene Summary:
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq