Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

RETN (Human) Recombinant Protein BioActive

  • Catalog # : P3665
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RETN (Q9HD89, 17 a.a. - 108 a.a.) partial recombinant protein with Fc tag expressed in HEK cell.
  • Sequence:
  • SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20 (non-reducing con
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to stimulate lipolysis in cultured human adipocytes.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • RETN
  • Gene Alias:
  • ADSF,FIZZ3,MGC126603,MGC126609,RETN1,RSTN,XCP1
  • Gene Description:
  • resistin
  • Gene Summary:
  • This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq
  • Other Designations:
  • C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1,found in inflammatory zone 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook