KRTAP10-2 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KRTAP10-2 protein.
Immunogen
KRTAP10-2 (AAI46566.1, 1 a.a. ~ 255 a.a) full-length human protein.
Sequence
MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KRTAP10-2 expression in transfected 293T cell line (H00386679-T02) by KRTAP10-2 MaxPab polyclonal antibody.
Lane 1: KRTAP10-2 transfected lysate(28.05 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KRTAP10-2
Entrez GeneID
386679GeneBank Accession#
BC146565Protein Accession#
AAI46566.1Gene Name
KRTAP10-2
Gene Alias
KAP10.2, KAP18-2, KAP18.2, KRTAP10.2, KRTAP18-2, KRTAP18.2
Gene Description
keratin associated protein 10-2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This gene encodes a member of the high sulfur KAP family. It is localized to a cluster of intronless KAPs at 21q22.3 which are located within the introns of the C21orf29 gene. [provided by RefSeq
Other Designations
OTTHUMP00000063321|high sulfur keratin-associated protein 10.2|keratin-associated protein 18-2|keratin-associated protein 18.2
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com