Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

LCN12 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00286256-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LCN12 protein.
  • Immunogen:
  • LCN12 (AAH41168, 1 a.a. ~ 355 a.a) full-length human protein.
  • Sequence:
  • MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPAGMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLSWATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLGYLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPWVAAPA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LCN12 expression in transfected 293T cell line (H00286256-T01) by LCN12 MaxPab polyclonal antibody.

    Lane 1: LCN12 transfected lysate(39.05 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • LCN12
  • Gene Alias:
  • MGC34753,MGC48935
  • Gene Description:
  • lipocalin 12
  • Gene Summary:
  • Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000022666,OTTHUMP00000022670,lipocalcin 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook