LASS6 monoclonal antibody (M01), clone 5H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LASS6.
Immunogen
LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LASS6 monoclonal antibody (M01), clone 5H7 Western Blot analysis of LASS6 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LASS6 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LASS6
Entrez GeneID
253782GeneBank Accession#
NM_203463Protein Accession#
NP_982288Gene Name
LASS6
Gene Alias
CerS6, MGC129949, MGC129950
Gene Description
LAG1 homolog, ceramide synthase 6
Gene Ontology
HyperlinkGene Summary
O
Other Designations
LAG1 longevity assurance homolog 6|longevity assurance homolog 6
-
Interactome
-
Disease
-
Publication Reference
-
CerS6-dependent ceramide synthesis in hypothalamic neurons promotes ER/mitochondrial stress and impairs glucose homeostasis in obese mice.
Philipp Hammerschmidt, Sophie M Steculorum, Cécile L Bandet, Almudena Del Río-Martín, Lukas Steuernagel, Vivien Kohlhaas, Marvin Feldmann, Luis Varela, Adam Majcher, Marta Quatorze Correia, Rhena F U Klar, Corinna A Bauder, Ecem Kaya, Marta Porniece, Nasim Biglari, Anna Sieben, Tamas L Horvath, Thorsten Hornemann, Susanne Brodesser, Jens C Brüning.
Nature Communications 2023 Nov; 14(1):7824.
Application:WB, Mouse, Hypothalamus, mHypoE-N43/5 cells.
-
Dependence of ABCB1 transporter expression and function on distinct sphingolipids generated by ceramide synthases-2 and -6 in chemoresistant renal cancer.
Wing-Kee Lee, Michelle Maaß, Amy Quach, Nataliya Poscic, Holly Prangley, Erin-Claire Pallott, Jiyoon L Kim, Jason S Pierce, Besim Ogretmen, Anthony H Futerman, Frank Thévenod.
The Journal of Biological Chemistry 2021 Dec; 13:101492.
Application:IF, WB, Human, ACHN, A498, Caki-1, HPCT cells..
-
Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype.
Trishna Pani, Kajal Rajput, Animesh Kar, Harsh Sharma, Rituparna Basak, Nihal Medatwal, Sandhini Saha, Gagan Dev, Sharwan Kumar, Siddhi Gupta, Arnab Mukhopadhyay, Dipankar Malakar, Tushar Kanti Maiti, Aneeshkumar G Arimbasseri, S V S Deo, Ravi Datta Sharma, Avinash Bajaj, Ujjaini Dasgupta.
Cell Death & Disease 2021 Feb; 12(2):171.
Application:WB-Tr, Human, BT-474 cells.
-
CERS6 required for cell migration and metastasis in lung cancer.
Motoshi Suzuki, Ke Cao, Seiichi Kato, Naoki Mizutani, Kouji Tanaka, Chinatsu Arima, Mei Chee Tai, Norie Nakatani, Kiyoshi Yanagisawa, Toshiyuki Takeuchi, Hanxiao Shi, Yasuyoshi Mizutani, Atsuko Niimi, Tetsuo Taniguchi, Takayuki Fukui, Kohei Yokoi, Keiko Wakahara, Yoshinori Hasegawa, Yukiko Mizutani, Soichiro Iwaki, Satoshi Fujii, Akira Satou, Keiko Tamiya-Koizumi, Takashi Murate, Mamoru Kyogashima, Shuta Tomida, Takashi Takahashi.
Journal of Cellular and Molecular Medicine 2020 Oct; 24(20):11949.
Application:IHC-P, WB-Ce, WB-Tr, Human, BEAS-2B, LNM35, RERF-LC-AI cells, Human lung cancer.
-
Ceramide synthase 6 predicts the prognosis of human gastric cancer: it functions as an oncoprotein by dysregulating the SOCS2/JAK2/STAT3 pathway.
Uen YH, Fang CL, Lin CC, Hseu YC, Hung ST, Sun DP, Lin KY.
Molecular Carcinogenesis 2018 Dec; 57(12):1675.
Application:IHC-P, WB, Human, 23132/87, AGS, HGC-27, NCI-N87, SK-GT-2, TMC-1, TSGH 9201 cells, Human gastric cancer.
-
CerS6 regulates cisplatin resistance in oral squamous cell carcinoma by altering mitochondrial fission and autophagy.
Li S, Wu Y, Ding Y, Yu M, Ai Z.
Journal of Cellular Physiology 2018 Dec; 233(12):9416.
Application:WB, WB-Tr, Human, Cal27‐CisR, Cal27 cells.
-
Sphingosine-1-phosphate lyase deficient cells as a tool to study protein lipid interactions.
Gerl MJ, Bittl V, Kirchner S, Sachsenheimer T, Brunner HL, Luchtenborg C, Ozbalci C, Wiedemann H, Wegehingel S, Nickel W, Haberkant P, Schultz C, Kruger M, Brugger B.
PLoS One 2016 Apr; 11(4):e0153009.
Application:WB-Tr, Human, HeLa cells.
-
Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells.
Suzuki M, Cao K, Kato S, Komizu Y, Mizutani N, Tanaka K, Arima C, Tai MC, Yanagisawa K, Togawa N, Shiraishi T, Usami N, Taniguchi T, Fukui T, Yokoi K, Wakahara K, Hasegawa Y, Mizutani Y, Igarashi Y, Inokuchi JI, Iwaki S, Fujii S, Satou A, Matsumoto Y, Ueoka R, Tamiya-Koizumi K, Murate T, Nakamura M, Kyogashima M, Takahashi T.
The Journal of Clinical Investigation 2016 Jan; 126(1):254.
Application:WB, Human, LNM35 cells.
-
Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.
Jensen SA, Calvert AE, Volpert G, Kouri FM, Hurley LA, Luciano JP, Wu Y, Chalastanis A, Futerman AH, Stegh AH.
PNAS 2014 Apr; 111(15):5682.
Application:WB-Ce, Human, SF767 cells.
-
Modulation of ceramide synthase activity via dimerization.
Laviad EL, Kelly S, Merrill AH Jr, Futerman AH.
The Journal of Biological Chemistry 2012 Jun; 287(25):21025.
Application:IP, WB, Human, HepG2 cells.
-
D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells.
Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S.
Biochimie 2011 Sep; 93(9):1446.
Application:WB-Ce, Human, A-549 cells.
-
Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
Mesicek J, Lee H, Feldman T, Jiang X, Skobeleva A, Berdyshev EV, Haimovitz-Friedman A, Fuks Z, Kolesnick R.
Cellular Signalling 2010 Sep; 22(9):1300.
Application:IP, WB, Human, HeLa cells.
-
Acid ceramidase 1 expression correlates with a better prognosis in ER-positive breast cancer.
Ruckhaberle E, Holtrich U, Engels K, Hanker L, Gatje R, Metzler D, Karn T, Kaufmann M, Rody A.
Climacteric : the Journal of the International Menopause Society 2009 Dec; 12(6):502.
Application:IHC-P, Human, Human breast cancer.
-
CerS6-dependent ceramide synthesis in hypothalamic neurons promotes ER/mitochondrial stress and impairs glucose homeostasis in obese mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com