Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SLC16A9 DNAxPab DNAxPabDNAxPab

  • Catalog # : H00220963-W03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human SLC16A9 DNA using DNAx™ Immune technology.
  • Immunogen:
  • SLC16A9 (ADR83371.1, 158 a.a. ~ 341 a.a) partial-length human DNA
  • Sequence:
  • QRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Gene Name:
  • SLC16A9
  • Gene Alias:
  • C10orf36,FLJ43803,MCT9
  • Gene Description:
  • solute carrier family 16, member 9 (monocarboxylic acid transporter 9)
  • Other Designations:
  • OTTHUMP00000178988,OTTHUMP00000178989,monocarboxylate transporter 9,solute carrier family 16 (monocarboxylic acid transporters), member 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook